- Certificate
- IP-COA-TS-261006
- Issued
- 6 October 2026
- Status
- released
Tesamorelin
Stabilised analogue of growth hormone releasing hormone
- 5 mg
- 10 mg
- IdentityConfirmedMass spectrometry
- Endotoxin< 0.125 EU/mgKinetic chromogenic LAL
- SterilityNo growthMembrane filtration
- Analysed5 October 2026Batch made 2 October 2026
Full analytical results
Tests and specifications
| Test | Method | Specification | Result | Status |
|---|---|---|---|---|
| Appearance | Visual inspection | White to off-white lyophilised powder | Conforms | Pass |
| Purity | RP-HPLC (C18, 214 nm, water/acetonitrile with 0.1% TFA) | ≥ 99.0% | 99.45% | Pass |
| Identity | ESI-MS | [M+5H]5+ = 1028.18 ± 0.50 | 1028.29 | Pass |
| Related substances | RP-HPLC, any single impurity | ≤ 1.0% | 0.25% | Pass |
| Total peptide content | UV absorbance at 280 nm against reference standard | ≥ 80.0% | 87.0% | Pass |
| Water content | Karl Fischer titration | ≤ 8.0% | 3.79% | Pass |
| Acetate content | Ion chromatography | ≤ 15.0% | 6.7% | Pass |
| pH, 1% aqueous solution | Potentiometry at 25 °C | 4.0 to 7.5 | 5.9 | Pass |
| Bacterial endotoxins | Kinetic chromogenic LAL | < 1.0 EU/mg | < 0.125 EU/mg | Pass |
| Sterility | Membrane filtration (USP <71>) | No growth | No growth | Pass |
| Residual solvents | Headspace GC-FID (USP <467>) | Acetonitrile ≤ 410 ppm, methanol ≤ 3000 ppm, dichloromethane ≤ 600 ppm (ICH Q3C) | Conforms | Pass |
| Elemental impurities | ICP-MS (USP <232> and <233>) | Pb ≤ 5, Cd ≤ 2, As ≤ 15, Hg ≤ 3 µg/day (ICH Q3D, parenteral) | Conforms | Pass |
Chromatogram
Reversed-phase trace for this batch. One dominant peak at 20.7 minutes, 99.45% of the total peak area, largest single impurity 0.25%.
Mass spectrum
Electrospray ionisation. Expected 1028.18, observed 1028.29, a difference of 0.11 m/z at charge state 5. The neighbouring peaks are the same molecule at the charge states either side of it.
Reference data
- CAS number
- 218949-48-5
- Molecular formula
- C221H366N72O67S
- Molecular weight
- 5135.86 g/mol
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Modifications
- A trans-3-hexenoyl group on the N-terminal tyrosine, and an amidated C-terminus. The backbone is unaltered GHRH 1-44, so Asn8, Gly15 and Met27 are all retained; that methionine is the single sulfur in the formula, and it is what separates this molecule from the CJC-1295 forms, which have none.
Public reference values for the compound, not measurements on this batch. The batch measurements are in the table above.
Storage and handling
- Unopened
- 2 to 8 °C, away from light
- Long term
- −20 °C, lyophilised, for the stated shelf life
- Reconstituted
- 2 to 8 °C, use within 4 weeks; avoid repeated freeze and thaw
- In transit
- Stable at ambient temperature for up to 30 days
- Reconstitute with
- Bacteriostatic water
The vial this covers
The label on your vial carries the same batch code as this certificate, IP-TS-261002, and the QR goes to the results for it. If the code on the vial is not this one, the certificate for it is on this page under earlier batches.
Sticker shown at its printed size, 40 by 20 mm. Cap colour may vary by batch.
Release
- Batch date
- 2 October 2026
- Analysis date
- 5 October 2026
- Issue date
- 6 October 2026
- Best before
- October 2028
- Released by
- Quality review, Indigo Peptides
- Document
- Valid only in its original, unmodified form
Results are taken from the batch testing documentation for this exact batch, supplied with the finished vials and held on file by us. Every value above is for the batch named on this certificate and for no other.
Holding an older vial?
| Batch | purity | Analysed |
|---|---|---|
| IP-TS-260914 | 99.35% | 17 September 2026 |
If the code on your vial is one of these, it is an earlier batch of ours and these are its results. A result we have published is never removed and never recalculated.
Take it with you
Download this certificate (PDF)
The PDF is this page on A4. Open the printable version to print it yourself.